PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0011s0817.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family SRS
Protein Properties Length: 347aa    MW: 35577.6 Da    PI: 8.0707
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0011s0817.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702201.82e-621202794154
               DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                           +++CqdCGnqakkdC+h+RCRtCCksrg+dC+thvkstWvpa++rrerq  ++++ +++a+ + +a s  k+    ++++a+s+t+ s+
  Kaladp0011s0817.1.p 120 SSSTCQDCGNQAKKDCSHRRCRTCCKSRGYDCSTHVKSTWVPASRRRERQLLASSTGASSASMSLSAGSGVKKARLVSSNAATSHTSNSN 209
                          5689*********************************************98888888888877777777777777777777777777555 PP

               DUF702  94 aeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                           ++++++et+s          lP ++ ++a f+cv+v+s++dg++e+aYq+ v+igGhvfkG+LydqG e+
  Kaladp0011s0817.1.p 210 -TPPRSFETTSchqdptfketLPGQILAPATFKCVKVTSINDGDDEFAYQAMVKIGGHVFKGFLYDQGEES 279
                          .56778888888899*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.7E-59121278IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.0E-27123165IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.8E-26230276IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MWPPSSAARV LNYSIPHDMG MVGLRDLFVV APASSFHHSS LNEPNLMAEG LGGGNPATAL  60
GVGLGVIPLL TAAPCIADDG GVNGRSSRGG GGIQLWQNPG LNGGNNNNAS VMQTMGASSS  120
SSTCQDCGNQ AKKDCSHRRC RTCCKSRGYD CSTHVKSTWV PASRRRERQL LASSTGASSA  180
SMSLSAGSGV KKARLVSSNA ATSHTSNSNT PPRSFETTSC HQDPTFKETL PGQILAPATF  240
KCVKVTSIND GDDEFAYQAM VKIGGHVFKG FLYDQGEESG TREHQQPGMP NISDLHLGGG  300
NGGGGMHKVS CSTTGLEAPL ADVYGGGSTS GGGILGGSGY GNPIIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ8477580.0GQ847758.1 Kalanchoe blossfeldiana cultivar Celine SHI-related protein SRS2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007015295.11e-105Lateral root primordium protein-related isoform 3, partial
SwissprotQ94CK93e-80LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLE2D5501e-118E2D550_KALBL; SHI-related protein SRS2 (Fragment)
STRINGGLYMA14G03900.15e-98(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.41e-67Lateral root primordium (LRP) protein-related